Anti RRS1 pAb (ATL-HPA055549 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055549-25

• 
• 
• 

Protein Description: RRS1 ribosome biogenesis regulator homolog (S. cerevisiae)
Gene Name: RRS1
Alternative Gene Name: KIAA0112
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061024: 99%, ENSRNOG00000007240: 99%
Entrez Gene ID: 23212
Uniprot ID: Q15050
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKP
• Gene Sequence: LHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKP
• Gene ID - Mouse: ENSMUSG00000061024
• Gene ID - Rat: ENSRNOG00000007240
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RRS1 pAb (ATL-HPA055549 w/enhanced validation) – 1 Found

Cao, Pengbo; Yang, Aiqing; Li, Peiyao; Xia, Xia; Han, Yuqing; Zhou, Guangming; Wang, Rui; Yang, Fei; Li, Yuanfeng; Zhang, Ying; Cui, Ying; Ji, Hongzan; Lu, Lei; He, Fuchu; Zhou, Gangqiao. Genomic gain of RRS1 promotes hepatocellular carcinoma through reducing the RPL11-MDM2-p53 signaling. Science Advances. 2021;7(35)