Anti RRP8 pAb (ATL-HPA057562)

Atlas Antibodies

SKU:
ATL-HPA057562-100
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ribosomal RNA processing 8, methyltransferase, homolog (yeast)
Gene Name: RRP8
Alternative Gene Name: KIAA0409
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030888: 70%, ENSRNOG00000018766: 67%
Entrez Gene ID: 23378
Uniprot ID: O43159
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKNKFQPPQVPDQAPAEAPTEKTEVSPVPRTDSHEARAGALRARMAQRLDGARFRYLNE
Gene Sequence AWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKNKFQPPQVPDQAPAEAPTEKTEVSPVPRTDSHEARAGALRARMAQRLDGARFRYLNE
Gene ID - Mouse ENSMUSG00000030888
Gene ID - Rat ENSRNOG00000018766
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RRP8 pAb (ATL-HPA057562)
Datasheet Anti RRP8 pAb (ATL-HPA057562) Datasheet (External Link)
Vendor Page Anti RRP8 pAb (ATL-HPA057562) at Atlas Antibodies

Documents & Links for Anti RRP8 pAb (ATL-HPA057562)
Datasheet Anti RRP8 pAb (ATL-HPA057562) Datasheet (External Link)
Vendor Page Anti RRP8 pAb (ATL-HPA057562)