Anti RRP7A pAb (ATL-HPA046768)

Atlas Antibodies

SKU: ATL-HPA046768-25

• 

Protein Description: ribosomal RNA processing 7 homolog A
Gene Name: RRP7A
Alternative Gene Name: CGI-96
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018040: 93%, ENSRNOG00000022896: 93%
Entrez Gene ID: 27341
Uniprot ID: Q9Y3A4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRS
• Gene Sequence: AYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRS
• Gene ID - Mouse: ENSMUSG00000018040
• Gene ID - Rat: ENSRNOG00000022896
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.