Anti RRM2 pAb (ATL-HPA056994 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA056994-25

• 
• 
• 

Protein Description: ribonucleotide reductase M2
Gene Name: RRM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020649: 72%, ENSRNOG00000054286: 68%
Entrez Gene ID: 6241
Uniprot ID: P31350
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRE
• Gene Sequence: LAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRE
• Gene ID - Mouse: ENSMUSG00000020649
• Gene ID - Rat: ENSRNOG00000054286
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RRM2 pAb (ATL-HPA056994 w/enhanced validation) – 2 Found

Ly, Tony; Whigham, Arlene; Clarke, Rosemary; Brenes-Murillo, Alejandro J; Estes, Brett; Madhessian, Diana; Lundberg, Emma; Wadsworth, Patricia; Lamond, Angus I. Proteomic analysis of cell cycle progression in asynchronous cultures, including mitotic subphases, using PRIMMUS. Elife. 2017;6( 29052541) 

Cheng, Wei-Chung; Chang, Chun-Yu; Lo, Chia-Chien; Hsieh, Chih-Ying; Kuo, Ting-Ting; Tseng, Guan-Chin; Wong, Sze-Ching; Chiang, Shu-Fen; Huang, Kevin Chih-Yang; Lai, Liang-Chuan; Lu, Tzu-Pin; Chao, K S Clifford; Sher, Yuh-Pyng. Identification of theranostic factors for patients developing metastasis after surgery for early-stage lung adenocarcinoma. Theranostics. 11(8):3661-3675.