Anti RRM1 pAb (ATL-HPA057265)

Atlas Antibodies

SKU:
ATL-HPA057265-25
  • Immunohistochemical staining of human tonsil shows cytoplasmic positivity in germinal center.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ribonucleotide reductase M1
Gene Name: RRM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030978: 99%, ENSRNOG00000045752: 99%
Entrez Gene ID: 6240
Uniprot ID: P23921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQT
Gene Sequence LVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQT
Gene ID - Mouse ENSMUSG00000030978
Gene ID - Rat ENSRNOG00000045752
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RRM1 pAb (ATL-HPA057265)
Datasheet Anti RRM1 pAb (ATL-HPA057265) Datasheet (External Link)
Vendor Page Anti RRM1 pAb (ATL-HPA057265) at Atlas Antibodies

Documents & Links for Anti RRM1 pAb (ATL-HPA057265)
Datasheet Anti RRM1 pAb (ATL-HPA057265) Datasheet (External Link)
Vendor Page Anti RRM1 pAb (ATL-HPA057265)