Anti RRAS2 pAb (ATL-HPA050942)

Atlas Antibodies

SKU: ATL-HPA050942-25

• 

Protein Description: related RAS viral (r-ras) oncogene homolog 2
Gene Name: RRAS2
Alternative Gene Name: TC21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055723: 100%, ENSRNOG00000012258: 100%
Entrez Gene ID: 22800
Uniprot ID: P62070
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRV
• Gene Sequence: DLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRV
• Gene ID - Mouse: ENSMUSG00000055723
• Gene ID - Rat: ENSRNOG00000012258
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.