Anti RPS9 pAb (ATL-HPA048746)
Atlas Antibodies
- SKU:
- ATL-HPA048746-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RPS9
Alternative Gene Name: S9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006333: 100%, ENSRNOG00000058909: 100%
Entrez Gene ID: 6203
Uniprot ID: P46781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNA |
Gene Sequence | ELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNA |
Gene ID - Mouse | ENSMUSG00000006333 |
Gene ID - Rat | ENSRNOG00000058909 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RPS9 pAb (ATL-HPA048746) | |
Datasheet | Anti RPS9 pAb (ATL-HPA048746) Datasheet (External Link) |
Vendor Page | Anti RPS9 pAb (ATL-HPA048746) at Atlas Antibodies |
Documents & Links for Anti RPS9 pAb (ATL-HPA048746) | |
Datasheet | Anti RPS9 pAb (ATL-HPA048746) Datasheet (External Link) |
Vendor Page | Anti RPS9 pAb (ATL-HPA048746) |