Anti RPS6KA2 pAb (ATL-HPA054237)

Atlas Antibodies

SKU: ATL-HPA054237-25

• 

Protein Description: ribosomal protein S6 kinase, 90kDa, polypeptide 2
Gene Name: RPS6KA2
Alternative Gene Name: HU-2, RSK, RSK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023809: 88%, ENSRNOG00000013194: 88%
Entrez Gene ID: 6196
Uniprot ID: Q15349
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIK
• Gene Sequence: VASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIK
• Gene ID - Mouse: ENSMUSG00000023809
• Gene ID - Rat: ENSRNOG00000013194
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.