Anti RPS6KA2 pAb (ATL-HPA045061)

Atlas Antibodies

SKU:
ATL-HPA045061-25
  • Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S6 kinase, 90kDa, polypeptide 2
Gene Name: RPS6KA2
Alternative Gene Name: HU-2, RSK, RSK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023809: 90%, ENSRNOG00000013194: 88%
Entrez Gene ID: 6196
Uniprot ID: Q15349
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGF
Gene Sequence MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGF
Gene ID - Mouse ENSMUSG00000023809
Gene ID - Rat ENSRNOG00000013194
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RPS6KA2 pAb (ATL-HPA045061)
Datasheet Anti RPS6KA2 pAb (ATL-HPA045061) Datasheet (External Link)
Vendor Page Anti RPS6KA2 pAb (ATL-HPA045061) at Atlas Antibodies

Documents & Links for Anti RPS6KA2 pAb (ATL-HPA045061)
Datasheet Anti RPS6KA2 pAb (ATL-HPA045061) Datasheet (External Link)
Vendor Page Anti RPS6KA2 pAb (ATL-HPA045061)