Anti RPS17 pAb (ATL-HPA055060)

Atlas Antibodies

SKU:
ATL-HPA055060-100
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoli, cytosol & endoplasmic reticulum.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S17
Gene Name: RPS17
Alternative Gene Name: MGC72007, RPS17L, RPS17L1, RPS17L2, S17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061787: 100%, ENSRNOG00000045885: 100%
Entrez Gene ID: 6218
Uniprot ID: P08708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKL
Gene Sequence RGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKL
Gene ID - Mouse ENSMUSG00000061787
Gene ID - Rat ENSRNOG00000045885
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RPS17 pAb (ATL-HPA055060)
Datasheet Anti RPS17 pAb (ATL-HPA055060) Datasheet (External Link)
Vendor Page Anti RPS17 pAb (ATL-HPA055060) at Atlas Antibodies

Documents & Links for Anti RPS17 pAb (ATL-HPA055060)
Datasheet Anti RPS17 pAb (ATL-HPA055060) Datasheet (External Link)
Vendor Page Anti RPS17 pAb (ATL-HPA055060)