Anti RPP38 pAb (ATL-HPA050398)

Atlas Antibodies

SKU:
ATL-HPA050398-25
  • Immunohistochemical staining of human kidney shows strong nuclear positivity in cells in glomeruli and cells in tubules.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ribonuclease P/MRP subunit p38
Gene Name: RPP38
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049950: 85%, ENSRNOG00000038025: 84%
Entrez Gene ID: 10557
Uniprot ID: P78345
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLALAFK
Gene Sequence TDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLALAFK
Gene ID - Mouse ENSMUSG00000049950
Gene ID - Rat ENSRNOG00000038025
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RPP38 pAb (ATL-HPA050398)
Datasheet Anti RPP38 pAb (ATL-HPA050398) Datasheet (External Link)
Vendor Page Anti RPP38 pAb (ATL-HPA050398) at Atlas Antibodies

Documents & Links for Anti RPP38 pAb (ATL-HPA050398)
Datasheet Anti RPP38 pAb (ATL-HPA050398) Datasheet (External Link)
Vendor Page Anti RPP38 pAb (ATL-HPA050398)