Anti RPP38 pAb (ATL-HPA045128 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045128-25

• 
• 

Protein Description: ribonuclease P/MRP 38kDa subunit
Gene Name: RPP38
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049950: 75%, ENSRNOG00000038025: 70%
Entrez Gene ID: 10557
Uniprot ID: P78345
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKS
• Gene Sequence: FVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKS
• Gene ID - Mouse: ENSMUSG00000049950
• Gene ID - Rat: ENSRNOG00000038025
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.