Anti RPP25L pAb (ATL-HPA059698)

Atlas Antibodies

SKU: ATL-HPA059698-25

• 

Protein Description: ribonuclease P/MRP 25kDa subunit-like
Gene Name: RPP25L
Alternative Gene Name: bA296L22.5, C9orf23, MGC29635
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036114: 94%, ENSRNOG00000059653: 94%
Entrez Gene ID: 138716
Uniprot ID: Q8N5L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLE
• Gene Sequence: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLE
• Gene ID - Mouse: ENSMUSG00000036114
• Gene ID - Rat: ENSRNOG00000059653
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.