Anti RPP25L pAb (ATL-HPA052187)

Atlas Antibodies

SKU:
ATL-HPA052187-25
  • Immunohistochemical staining of human adrenal gland shows moderate cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ribonuclease P/MRP 25kDa subunit-like
Gene Name: RPP25L
Alternative Gene Name: bA296L22.5, C9orf23, MGC29635
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036114: 94%, ENSRNOG00000059653: 95%
Entrez Gene ID: 138716
Uniprot ID: Q8N5L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
Gene Sequence LTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
Gene ID - Mouse ENSMUSG00000036114
Gene ID - Rat ENSRNOG00000059653
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RPP25L pAb (ATL-HPA052187)
Datasheet Anti RPP25L pAb (ATL-HPA052187) Datasheet (External Link)
Vendor Page Anti RPP25L pAb (ATL-HPA052187) at Atlas Antibodies

Documents & Links for Anti RPP25L pAb (ATL-HPA052187)
Datasheet Anti RPP25L pAb (ATL-HPA052187) Datasheet (External Link)
Vendor Page Anti RPP25L pAb (ATL-HPA052187)