Anti RPL8 pAb (ATL-HPA050165 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA050165-25
  • Immunohistochemical staining of human cerebellum, fallopian tube, pancreas and skin using Anti-RPL8 antibody HPA050165 (A) shows similar protein distribution across tissues to independent antibody HPA045095 (B).
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli, cytosol & endoplasmic reticulum.
  • Western blot analysis using Anti-RPL8 antibody HPA050165 (A) shows similar pattern to independent antibody HPA045095 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L8
Gene Name: RPL8
Alternative Gene Name: L8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003970: 100%, ENSRNOG00000048523: 100%
Entrez Gene ID: 6132
Uniprot ID: P62917
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEK
Gene Sequence VISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEK
Gene ID - Mouse ENSMUSG00000003970
Gene ID - Rat ENSRNOG00000048523
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RPL8 pAb (ATL-HPA050165 w/enhanced validation)
Datasheet Anti RPL8 pAb (ATL-HPA050165 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RPL8 pAb (ATL-HPA050165 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RPL8 pAb (ATL-HPA050165 w/enhanced validation)
Datasheet Anti RPL8 pAb (ATL-HPA050165 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RPL8 pAb (ATL-HPA050165 w/enhanced validation)



Citations for Anti RPL8 pAb (ATL-HPA050165 w/enhanced validation) – 1 Found
Sorroche, Fernando; Morales, Violette; Mouffok, Saïda; Pichereaux, Carole; Garnerone, A Marie; Zou, Lan; Soni, Badrish; Carpéné, Marie-Anne; Gargaros, Audrey; Maillet, Fabienne; Burlet-Schiltz, Odile; Poinsot, Verena; Polard, Patrice; Gough, Clare; Batut, Jacques. The ex planta signal activity of a Medicago ribosomal uL2 protein suggests a moonlighting role in controlling secondary rhizobial infection. Plos One. 15(10):e0235446.  PubMed