Anti RPL8 pAb (ATL-HPA045095 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045095-25

• 
• 

Protein Description: ribosomal protein L8
Gene Name: RPL8
Alternative Gene Name: L8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003970: 100%, ENSRNOG00000048523: 100%
Entrez Gene ID: 6132
Uniprot ID: P62917
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETK
• Gene Sequence: LAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETK
• Gene ID - Mouse: ENSMUSG00000003970
• Gene ID - Rat: ENSRNOG00000048523
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.