Anti RPL7L1 pAb (ATL-HPA046049 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046049-25

• 
• 

Protein Description: ribosomal protein L7-like 1
Gene Name: RPL7L1
Alternative Gene Name: dJ475N16.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063888: 78%, ENSRNOG00000016269: 81%
Entrez Gene ID: 285855
Uniprot ID: Q6DKI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGLRFKRLESFLHDSWRQKRDKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLV
• Gene Sequence: KGLRFKRLESFLHDSWRQKRDKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLV
• Gene ID - Mouse: ENSMUSG00000063888
• Gene ID - Rat: ENSRNOG00000016269
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.