Protein Description: ribosomal protein L21
Gene Name: RPL21
Alternative Gene Name: DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041453: 100%, ENSRNOG00000038458: 100%
Entrez Gene ID: 6144
Uniprot ID: P46778
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPL21
Alternative Gene Name: DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041453: 100%, ENSRNOG00000038458: 100%
Entrez Gene ID: 6144
Uniprot ID: P46778
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RGTRYMFSRPFRKHGVVPLATYMRIYKKGD |
| Documents & Links for Anti RPL21 pAb (ATL-HPA047252) | |
| Datasheet | Anti RPL21 pAb (ATL-HPA047252) Datasheet (External Link) |
| Vendor Page | Anti RPL21 pAb (ATL-HPA047252) at Atlas |
| Documents & Links for Anti RPL21 pAb (ATL-HPA047252) | |
| Datasheet | Anti RPL21 pAb (ATL-HPA047252) Datasheet (External Link) |
| Vendor Page | Anti RPL21 pAb (ATL-HPA047252) |