Anti RPL21 pAb (ATL-HPA047252)

Atlas Antibodies

SKU: ATL-HPA047252-25

• 
• 

Protein Description: ribosomal protein L21
Gene Name: RPL21
Alternative Gene Name: DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041453: 100%, ENSRNOG00000038458: 100%
Entrez Gene ID: 6144
Uniprot ID: P46778
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGTRYMFSRPFRKHGVVPLATYMRIYKKGD
• Gene Sequence: RGTRYMFSRPFRKHGVVPLATYMRIYKKGD
• Gene ID - Mouse: ENSMUSG00000041453
• Gene ID - Rat: ENSRNOG00000038458
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.