Anti RPL21 pAb (ATL-HPA047252)

Catalog No:
ATL-HPA047252-25
$303.00
Protein Description: ribosomal protein L21
Gene Name: RPL21
Alternative Gene Name: DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041453: 100%, ENSRNOG00000038458: 100%
Entrez Gene ID: 6144
Uniprot ID: P46778
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGTRYMFSRPFRKHGVVPLATYMRIYKKGD
Gene Sequence RGTRYMFSRPFRKHGVVPLATYMRIYKKGD
Gene ID - Mouse ENSMUSG00000041453
Gene ID - Rat ENSRNOG00000038458
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti RPL21 pAb (ATL-HPA047252)
Datasheet Anti RPL21 pAb (ATL-HPA047252) Datasheet (External Link)
Vendor Page Anti RPL21 pAb (ATL-HPA047252) at Atlas

Documents & Links for Anti RPL21 pAb (ATL-HPA047252)
Datasheet Anti RPL21 pAb (ATL-HPA047252) Datasheet (External Link)
Vendor Page Anti RPL21 pAb (ATL-HPA047252)