Anti RPL19 pAb (ATL-HPA051987)

Atlas Antibodies

SKU:
ATL-HPA051987-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol & endoplasmic reticulum.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L19
Gene Name: RPL19
Alternative Gene Name: DKFZp779D216, FLJ27452, L19, MGC71997
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017404: 100%, ENSRNOG00000004741: 100%
Entrez Gene ID: 6143
Uniprot ID: P84098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRH
Gene Sequence KGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRH
Gene ID - Mouse ENSMUSG00000017404
Gene ID - Rat ENSRNOG00000004741
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RPL19 pAb (ATL-HPA051987)
Datasheet Anti RPL19 pAb (ATL-HPA051987) Datasheet (External Link)
Vendor Page Anti RPL19 pAb (ATL-HPA051987) at Atlas Antibodies

Documents & Links for Anti RPL19 pAb (ATL-HPA051987)
Datasheet Anti RPL19 pAb (ATL-HPA051987) Datasheet (External Link)
Vendor Page Anti RPL19 pAb (ATL-HPA051987)