Anti RPL19 pAb (ATL-HPA051987)

Atlas Antibodies

SKU: ATL-HPA051987-25

• 

Protein Description: ribosomal protein L19
Gene Name: RPL19
Alternative Gene Name: DKFZp779D216, FLJ27452, L19, MGC71997
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017404: 100%, ENSRNOG00000004741: 100%
Entrez Gene ID: 6143
Uniprot ID: P84098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRH
• Gene Sequence: KGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRH
• Gene ID - Mouse: ENSMUSG00000017404
• Gene ID - Rat: ENSRNOG00000004741
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.