Anti RPL17 pAb (ATL-HPA046385)

Atlas Antibodies

SKU: ATL-HPA046385-100

• 
• 
• 

Protein Description: ribosomal protein L17
Gene Name: RPL17
Alternative Gene Name: L17, rpL23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062328: 100%, ENSRNOG00000018680: 100%
Entrez Gene ID: 6139
Uniprot ID: P18621
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLK
• Gene Sequence: RAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLK
• Gene ID - Mouse: ENSMUSG00000062328
• Gene ID - Rat: ENSRNOG00000018680
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.