Anti RPL13 pAb (ATL-HPA051702)

Atlas Antibodies

SKU:
ATL-HPA051702-100
  • Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in subset of non-germinal center cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli, cytosol & endoplasmic reticulum.
  • Western blot analysis in human cell line NB4.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L13
Gene Name: RPL13
Alternative Gene Name: BBC1, D16S444E, L13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000740: 99%, ENSRNOG00000059545: 97%
Entrez Gene ID: 6137
Uniprot ID: P26373
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQD
Gene Sequence PKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQD
Gene ID - Mouse ENSMUSG00000000740
Gene ID - Rat ENSRNOG00000059545
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RPL13 pAb (ATL-HPA051702)
Datasheet Anti RPL13 pAb (ATL-HPA051702) Datasheet (External Link)
Vendor Page Anti RPL13 pAb (ATL-HPA051702) at Atlas Antibodies

Documents & Links for Anti RPL13 pAb (ATL-HPA051702)
Datasheet Anti RPL13 pAb (ATL-HPA051702) Datasheet (External Link)
Vendor Page Anti RPL13 pAb (ATL-HPA051702)