Anti RPAP2 pAb (ATL-HPA046443)

Atlas Antibodies

SKU:
ATL-HPA046443-25
  • Immunohistochemical staining of human Testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli & cytoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: RNA polymerase II associated protein 2
Gene Name: RPAP2
Alternative Gene Name: C1orf82, FLJ13150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033773: 79%, ENSRNOG00000023484: 76%
Entrez Gene ID: 79871
Uniprot ID: Q8IXW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RCSRKAAGTKQTSTLKQEDASKRKAELEAAVRKKIEFERKALHIVEQLLEENITEEFLMECGRFITPAHYSDVVDERSIVKLCGYPLCQKKLGI
Gene Sequence RCSRKAAGTKQTSTLKQEDASKRKAELEAAVRKKIEFERKALHIVEQLLEENITEEFLMECGRFITPAHYSDVVDERSIVKLCGYPLCQKKLGI
Gene ID - Mouse ENSMUSG00000033773
Gene ID - Rat ENSRNOG00000023484
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RPAP2 pAb (ATL-HPA046443)
Datasheet Anti RPAP2 pAb (ATL-HPA046443) Datasheet (External Link)
Vendor Page Anti RPAP2 pAb (ATL-HPA046443) at Atlas Antibodies

Documents & Links for Anti RPAP2 pAb (ATL-HPA046443)
Datasheet Anti RPAP2 pAb (ATL-HPA046443) Datasheet (External Link)
Vendor Page Anti RPAP2 pAb (ATL-HPA046443)