Anti RP11-849H4.2 pAb (ATL-HPA051121)

Atlas Antibodies

SKU: ATL-HPA051121-25

• 
• 

Protein Description: Putative short transient receptor potential channel 2-like protein
Gene Name: RP11-849H4.2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070425: 56%, ENSRNOG00000020188: 28%
Entrez Gene ID:
Uniprot ID: Q6ZNB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QIDVGHSSWPLDRPFITLLPATTLMSLTDSKQGKNRSGVRMFKDGKEGKSRKDGGGLYEKQRCSTKEDCEC
• Gene Sequence: QIDVGHSSWPLDRPFITLLPATTLMSLTDSKQGKNRSGVRMFKDGKEGKSRKDGGGLYEKQRCSTKEDCEC
• Gene ID - Mouse: ENSMUSG00000070425
• Gene ID - Rat: ENSRNOG00000020188
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.