Anti ROCK1 pAb (ATL-HPA045639)

Atlas Antibodies

SKU: ATL-HPA045639-25

• 

Protein Description: Rho-associated, coiled-coil containing protein kinase 1
Gene Name: ROCK1
Alternative Gene Name: p160ROCK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024290: 97%, ENSRNOG00000031092: 97%
Entrez Gene ID: 6093
Uniprot ID: Q13464
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEDLICPCKVSYDVTSARDMLLLACSQDEQ
• Gene Sequence: KEDLICPCKVSYDVTSARDMLLLACSQDEQ
• Gene ID - Mouse: ENSMUSG00000024290
• Gene ID - Rat: ENSRNOG00000031092
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.