Anti RNPC3 pAb (ATL-HPA052434)

Atlas Antibodies

SKU: ATL-HPA052434-25

• 

Protein Description: RNA-binding region (RNP1, RRM) containing 3
Gene Name: RNPC3
Alternative Gene Name: FLJ20008, KIAA1839, RBM40, SNRNP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027981: 87%, ENSRNOG00000017310: 85%
Entrez Gene ID: 55599
Uniprot ID: Q96LT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTA
• Gene Sequence: MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTA
• Gene ID - Mouse: ENSMUSG00000027981
• Gene ID - Rat: ENSRNOG00000017310
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.