Anti RNF31 pAb (ATL-HPA048745)

Atlas Antibodies

SKU:
ATL-HPA048745-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
  • Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ring finger protein 31
Gene Name: RNF31
Alternative Gene Name: FLJ10111, FLJ23501, HOIP, ZIBRA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047098: 94%, ENSRNOG00000019438: 95%
Entrez Gene ID: 55072
Uniprot ID: Q96EP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGV
Gene Sequence ELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGV
Gene ID - Mouse ENSMUSG00000047098
Gene ID - Rat ENSRNOG00000019438
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RNF31 pAb (ATL-HPA048745)
Datasheet Anti RNF31 pAb (ATL-HPA048745) Datasheet (External Link)
Vendor Page Anti RNF31 pAb (ATL-HPA048745) at Atlas Antibodies

Documents & Links for Anti RNF31 pAb (ATL-HPA048745)
Datasheet Anti RNF31 pAb (ATL-HPA048745) Datasheet (External Link)
Vendor Page Anti RNF31 pAb (ATL-HPA048745)