Anti RNF212 pAb (ATL-HPA057527)

Atlas Antibodies

SKU:
ATL-HPA057527-25
  • Immunohistochemical staining of human cerebellum shows strong nuclear and cytoplasmic positivity in Purkinje cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ring finger protein 212
Gene Name: RNF212
Alternative Gene Name: FLJ38841, LOC285498
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063600: 27%, ENSRNOG00000013506: 24%
Entrez Gene ID: 285498
Uniprot ID: Q495C1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLLEFIKHVCYHRHQSHRPCAPGWFCQVLQRPGAVSGEKTQQTRPAPPATCLLCLSCLSGFRHGPWRSQALPSDLVAPLFVSYTVEVSITNAGWS
Gene Sequence KLLEFIKHVCYHRHQSHRPCAPGWFCQVLQRPGAVSGEKTQQTRPAPPATCLLCLSCLSGFRHGPWRSQALPSDLVAPLFVSYTVEVSITNAGWS
Gene ID - Mouse ENSMUSG00000063600
Gene ID - Rat ENSRNOG00000013506
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RNF212 pAb (ATL-HPA057527)
Datasheet Anti RNF212 pAb (ATL-HPA057527) Datasheet (External Link)
Vendor Page Anti RNF212 pAb (ATL-HPA057527) at Atlas Antibodies

Documents & Links for Anti RNF212 pAb (ATL-HPA057527)
Datasheet Anti RNF212 pAb (ATL-HPA057527) Datasheet (External Link)
Vendor Page Anti RNF212 pAb (ATL-HPA057527)