Protein Description: ring finger protein 19B
Gene Name: RNF19B
Alternative Gene Name: FLJ90005, IBRDC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028793: 96%, ENSRNOG00000000123: 98%
Entrez Gene ID: 127544
Uniprot ID: Q6ZMZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RNF19B
Alternative Gene Name: FLJ90005, IBRDC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028793: 96%, ENSRNOG00000000123: 98%
Entrez Gene ID: 127544
Uniprot ID: Q6ZMZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GSIISSYNPQDRECNNMEIQVDIEAKPSHYQLVSGSSTEDSLHVHAQMAENEEEG |
| Documents & Links for Anti RNF19B pAb (ATL-HPA063640) | |
| Datasheet | Anti RNF19B pAb (ATL-HPA063640) Datasheet (External Link) |
| Vendor Page | Anti RNF19B pAb (ATL-HPA063640) at Atlas |
| Documents & Links for Anti RNF19B pAb (ATL-HPA063640) | |
| Datasheet | Anti RNF19B pAb (ATL-HPA063640) Datasheet (External Link) |
| Vendor Page | Anti RNF19B pAb (ATL-HPA063640) |