Anti RNF181 pAb (ATL-HPA046112)

Atlas Antibodies

SKU: ATL-HPA046112-25

• 
• 
• 

Protein Description: ring finger protein 181
Gene Name: RNF181
Alternative Gene Name: HSPC238
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102720: 70%, ENSRNOG00000012035: 73%
Entrez Gene ID: 51255
Uniprot ID: Q9P0P0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCP
• Gene Sequence: ASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCP
• Gene ID - Mouse: ENSMUSG00000102720
• Gene ID - Rat: ENSRNOG00000012035
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.