Anti RNF168 pAb (ATL-HPA046109)

Atlas Antibodies

SKU:
ATL-HPA046109-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ring finger protein 168, E3 ubiquitin protein ligase
Gene Name: RNF168
Alternative Gene Name: FLJ35794
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014074: 43%, ENSRNOG00000043345: 42%
Entrez Gene ID: 165918
Uniprot ID: Q8IYW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTPKSQFGSASHSEAVQEVRKDSVSKDIDSSDRKSPTGQDTEIEDMPTLSPQISLGVGEQGADSSIESPMPWLCACGAEWYHEGNVKTRPSNHGK
Gene Sequence LTPKSQFGSASHSEAVQEVRKDSVSKDIDSSDRKSPTGQDTEIEDMPTLSPQISLGVGEQGADSSIESPMPWLCACGAEWYHEGNVKTRPSNHGK
Gene ID - Mouse ENSMUSG00000014074
Gene ID - Rat ENSRNOG00000043345
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RNF168 pAb (ATL-HPA046109)
Datasheet Anti RNF168 pAb (ATL-HPA046109) Datasheet (External Link)
Vendor Page Anti RNF168 pAb (ATL-HPA046109) at Atlas Antibodies

Documents & Links for Anti RNF168 pAb (ATL-HPA046109)
Datasheet Anti RNF168 pAb (ATL-HPA046109) Datasheet (External Link)
Vendor Page Anti RNF168 pAb (ATL-HPA046109)