Anti RNF165 pAb (ATL-HPA047798)
Atlas Antibodies
- SKU:
- ATL-HPA047798-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RNF165
Alternative Gene Name: ARKL2, RNF111L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025427: 99%, ENSRNOG00000048824: 99%
Entrez Gene ID: 494470
Uniprot ID: Q6ZSG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDGKGK |
Gene Sequence | VVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDGKGK |
Gene ID - Mouse | ENSMUSG00000025427 |
Gene ID - Rat | ENSRNOG00000048824 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RNF165 pAb (ATL-HPA047798) | |
Datasheet | Anti RNF165 pAb (ATL-HPA047798) Datasheet (External Link) |
Vendor Page | Anti RNF165 pAb (ATL-HPA047798) at Atlas Antibodies |
Documents & Links for Anti RNF165 pAb (ATL-HPA047798) | |
Datasheet | Anti RNF165 pAb (ATL-HPA047798) Datasheet (External Link) |
Vendor Page | Anti RNF165 pAb (ATL-HPA047798) |