Anti RNF165 pAb (ATL-HPA047798)

Atlas Antibodies

SKU:
ATL-HPA047798-25
  • Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ring finger protein 165
Gene Name: RNF165
Alternative Gene Name: ARKL2, RNF111L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025427: 99%, ENSRNOG00000048824: 99%
Entrez Gene ID: 494470
Uniprot ID: Q6ZSG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDGKGK
Gene Sequence VVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDGKGK
Gene ID - Mouse ENSMUSG00000025427
Gene ID - Rat ENSRNOG00000048824
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RNF165 pAb (ATL-HPA047798)
Datasheet Anti RNF165 pAb (ATL-HPA047798) Datasheet (External Link)
Vendor Page Anti RNF165 pAb (ATL-HPA047798) at Atlas Antibodies

Documents & Links for Anti RNF165 pAb (ATL-HPA047798)
Datasheet Anti RNF165 pAb (ATL-HPA047798) Datasheet (External Link)
Vendor Page Anti RNF165 pAb (ATL-HPA047798)