Anti RNF144A pAb (ATL-HPA049939)

Atlas Antibodies

SKU: ATL-HPA049939-25

• 
• 

Protein Description: ring finger protein 144A
Gene Name: RNF144A
Alternative Gene Name: KIAA0161, RNF144, UBCE7IP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020642: 100%, ENSRNOG00000007370: 100%
Entrez Gene ID: 9781
Uniprot ID: P50876
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC
• Gene Sequence: CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC
• Gene ID - Mouse: ENSMUSG00000020642
• Gene ID - Rat: ENSRNOG00000007370
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.