Anti RNF121 pAb (ATL-HPA046041 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046041-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, the Golgi apparatus & vesicles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and RNF121 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413163).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ring finger protein 121
Gene Name: RNF121
Alternative Gene Name: FLJ11099
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070426: 96%, ENSRNOG00000020175: 94%
Entrez Gene ID: 55298
Uniprot ID: Q9H920
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAAVVEVEVGGGAAGERELDEVDMSDLSPEEQWRVEHARMHAKHRGHEAMHA
Gene Sequence MAAVVEVEVGGGAAGERELDEVDMSDLSPEEQWRVEHARMHAKHRGHEAMHA
Gene ID - Mouse ENSMUSG00000070426
Gene ID - Rat ENSRNOG00000020175
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti RNF121 pAb (ATL-HPA046041 w/enhanced validation)
Datasheet Anti RNF121 pAb (ATL-HPA046041 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RNF121 pAb (ATL-HPA046041 w/enhanced validation)



Citations for Anti RNF121 pAb (ATL-HPA046041 w/enhanced validation) – 1 Found
Nishitsuji, Hironori; Iwahori, Satoko; Ohmori, Mariko; Shimotohno, Kunitada; Murata, Takayuki. Ubiquitination of SARS-CoV-2 NSP6 and ORF7a Facilitates NF-κB Activation. Mbio. 2022;13(4):e0097122.  PubMed