Anti RNF121 pAb (ATL-HPA046041 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046041-25

• 
• 
• 

Protein Description: ring finger protein 121
Gene Name: RNF121
Alternative Gene Name: FLJ11099
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070426: 96%, ENSRNOG00000020175: 94%
Entrez Gene ID: 55298
Uniprot ID: Q9H920
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAAVVEVEVGGGAAGERELDEVDMSDLSPEEQWRVEHARMHAKHRGHEAMHA
• Gene Sequence: MAAVVEVEVGGGAAGERELDEVDMSDLSPEEQWRVEHARMHAKHRGHEAMHA
• Gene ID - Mouse: ENSMUSG00000070426
• Gene ID - Rat: ENSRNOG00000020175
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RNF121 pAb (ATL-HPA046041 w/enhanced validation) – 1 Found

Nishitsuji, Hironori; Iwahori, Satoko; Ohmori, Mariko; Shimotohno, Kunitada; Murata, Takayuki. Ubiquitination of SARS-CoV-2 NSP6 and ORF7a Facilitates NF-κB Activation. Mbio. 2022;13(4):e0097122.