Anti RNF10 pAb (ATL-HPA052643)

Atlas Antibodies

SKU: ATL-HPA052643-25

• 
• 

Protein Description: ring finger protein 10
Gene Name: RNF10
Alternative Gene Name: KIAA0262, RIE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041740: 99%, ENSRNOG00000001172: 99%
Entrez Gene ID: 9921
Uniprot ID: Q8N5U6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQRHRYLSHLPLTCEFSICELALQPPVV
• Gene Sequence: SPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQRHRYLSHLPLTCEFSICELALQPPVV
• Gene ID - Mouse: ENSMUSG00000041740
• Gene ID - Rat: ENSRNOG00000001172
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.