Anti RNF10 pAb (ATL-HPA052643)
Atlas Antibodies
- SKU:
- ATL-HPA052643-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RNF10
Alternative Gene Name: KIAA0262, RIE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041740: 99%, ENSRNOG00000001172: 99%
Entrez Gene ID: 9921
Uniprot ID: Q8N5U6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQRHRYLSHLPLTCEFSICELALQPPVV |
Gene Sequence | SPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQRHRYLSHLPLTCEFSICELALQPPVV |
Gene ID - Mouse | ENSMUSG00000041740 |
Gene ID - Rat | ENSRNOG00000001172 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RNF10 pAb (ATL-HPA052643) | |
Datasheet | Anti RNF10 pAb (ATL-HPA052643) Datasheet (External Link) |
Vendor Page | Anti RNF10 pAb (ATL-HPA052643) at Atlas Antibodies |
Documents & Links for Anti RNF10 pAb (ATL-HPA052643) | |
Datasheet | Anti RNF10 pAb (ATL-HPA052643) Datasheet (External Link) |
Vendor Page | Anti RNF10 pAb (ATL-HPA052643) |