Anti RND3 pAb (ATL-HPA060504)

Atlas Antibodies

SKU:
ATL-HPA060504-25
  • Immunohistochemical staining of human kidney shows moderate membranous and cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho family GTPase 3
Gene Name: RND3
Alternative Gene Name: ARHE, Rho8, RhoE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017144: 96%, ENSRNOG00000004624: 96%
Entrez Gene ID: 390
Uniprot ID: P61587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTVL
Gene Sequence SHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTVL
Gene ID - Mouse ENSMUSG00000017144
Gene ID - Rat ENSRNOG00000004624
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RND3 pAb (ATL-HPA060504)
Datasheet Anti RND3 pAb (ATL-HPA060504) Datasheet (External Link)
Vendor Page Anti RND3 pAb (ATL-HPA060504) at Atlas Antibodies

Documents & Links for Anti RND3 pAb (ATL-HPA060504)
Datasheet Anti RND3 pAb (ATL-HPA060504) Datasheet (External Link)
Vendor Page Anti RND3 pAb (ATL-HPA060504)