Anti RNASE3 pAb (ATL-HPA056183 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA056183-25

• 
• 

Protein Description: ribonuclease, RNase A family, 3
Gene Name: RNASE3
Alternative Gene Name: ECP, RNS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072601: 38%, ENSRNOG00000053457: 45%
Entrez Gene ID: 6037
Uniprot ID: P12724
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVV
• Gene Sequence: CGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVV
• Gene ID - Mouse: ENSMUSG00000072601
• Gene ID - Rat: ENSRNOG00000053457
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.