Anti RNASE10 pAb (ATL-HPA052593)

Atlas Antibodies

SKU:
ATL-HPA052593-25
  • Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ribonuclease, RNase A family, 10 (non-active)
Gene Name: RNASE10
Alternative Gene Name: RNASE9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021872: 66%, ENSRNOG00000010261: 65%
Entrez Gene ID: 338879
Uniprot ID: Q5GAN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YAFIHEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCELSQPDQVTPNCNYLTSVIKKHIIITCNDMKRQLPTGQ
Gene Sequence YAFIHEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCELSQPDQVTPNCNYLTSVIKKHIIITCNDMKRQLPTGQ
Gene ID - Mouse ENSMUSG00000021872
Gene ID - Rat ENSRNOG00000010261
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RNASE10 pAb (ATL-HPA052593)
Datasheet Anti RNASE10 pAb (ATL-HPA052593) Datasheet (External Link)
Vendor Page Anti RNASE10 pAb (ATL-HPA052593) at Atlas Antibodies

Documents & Links for Anti RNASE10 pAb (ATL-HPA052593)
Datasheet Anti RNASE10 pAb (ATL-HPA052593) Datasheet (External Link)
Vendor Page Anti RNASE10 pAb (ATL-HPA052593)