Anti RMND5B pAb (ATL-HPA047778)

Atlas Antibodies

SKU: ATL-HPA047778-25

• 
• 
• 

Protein Description: required for meiotic nuclear division 5 homolog B (S. cerevisiae)
Gene Name: RMND5B
Alternative Gene Name: FLJ22318, GID2, GID2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001054: 96%, ENSRNOG00000047719: 96%
Entrez Gene ID: 64777
Uniprot ID: Q96G75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AIDRNFDSEICGVVSDAVWDAREQQQQILQMAIVEHLYQQGMLSVA
• Gene Sequence: AIDRNFDSEICGVVSDAVWDAREQQQQILQMAIVEHLYQQGMLSVA
• Gene ID - Mouse: ENSMUSG00000001054
• Gene ID - Rat: ENSRNOG00000047719
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.