Anti RMND5A pAb (ATL-HPA046795)

Atlas Antibodies

SKU: ATL-HPA046795-25

• 

Protein Description: required for meiotic nuclear division 5 homolog A (S. cerevisiae)
Gene Name: RMND5A
Alternative Gene Name: FLJ13910, GID2, GID2A, RMD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002222: 100%, ENSRNOG00000028422: 100%
Entrez Gene ID: 64795
Uniprot ID: Q9H871
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAE
• Gene Sequence: FDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAE
• Gene ID - Mouse: ENSMUSG00000002222
• Gene ID - Rat: ENSRNOG00000028422
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.