Anti RIT1 pAb (ATL-HPA053249)

Atlas Antibodies

Catalog No.:
ATL-HPA053249-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Ras-like without CAAX 1
Gene Name: RIT1
Alternative Gene Name: MGC125864, MGC125865, RIBB, RIT, ROC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028057: 93%, ENSRNOG00000020232: 91%
Entrez Gene ID: 6016
Uniprot ID: Q92963
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT
Gene Sequence AYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT
Gene ID - Mouse ENSMUSG00000028057
Gene ID - Rat ENSRNOG00000020232
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RIT1 pAb (ATL-HPA053249)
Datasheet Anti RIT1 pAb (ATL-HPA053249) Datasheet (External Link)
Vendor Page Anti RIT1 pAb (ATL-HPA053249) at Atlas Antibodies

Documents & Links for Anti RIT1 pAb (ATL-HPA053249)
Datasheet Anti RIT1 pAb (ATL-HPA053249) Datasheet (External Link)
Vendor Page Anti RIT1 pAb (ATL-HPA053249)



Citations for Anti RIT1 pAb (ATL-HPA053249) – 2 Found
Emery, Andrew C; Xu, Wenqin; Eiden, Maribeth V; Eiden, Lee E. Guanine nucleotide exchange factor Epac2-dependent activation of the GTP-binding protein Rap2A mediates cAMP-dependent growth arrest in neuroendocrine cells. The Journal Of Biological Chemistry. 2017;292(29):12220-12231.  PubMed
Takahara, Shingo; Inoue, Shin-Ichi; Miyagawa-Tomita, Sachiko; Matsuura, Katsuhisa; Nakashima, Yasumi; Niihori, Tetsuya; Matsubara, Yoichi; Saiki, Yoshikatsu; Aoki, Yoko. New Noonan syndrome model mice with RIT1 mutation exhibit cardiac hypertrophy and susceptibility to β-adrenergic stimulation-induced cardiac fibrosis. Ebiomedicine. 2019;42( 30898653):43-53.  PubMed