Anti RIPPLY2 pAb (ATL-HPA047454)

Atlas Antibodies

SKU:
ATL-HPA047454-25
  • Immunohistochemical staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ripply transcriptional repressor 2
Gene Name: RIPPLY2
Alternative Gene Name: C6orf159, dJ237I15.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047897: 45%, ENSRNOG00000010004: 43%
Entrez Gene ID: 134701
Uniprot ID: Q5TAB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MENAGGAEGTESGAAACAATDGPTRRAGADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASGKLYQFRHPV
Gene Sequence MENAGGAEGTESGAAACAATDGPTRRAGADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASGKLYQFRHPV
Gene ID - Mouse ENSMUSG00000047897
Gene ID - Rat ENSRNOG00000010004
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RIPPLY2 pAb (ATL-HPA047454)
Datasheet Anti RIPPLY2 pAb (ATL-HPA047454) Datasheet (External Link)
Vendor Page Anti RIPPLY2 pAb (ATL-HPA047454) at Atlas Antibodies

Documents & Links for Anti RIPPLY2 pAb (ATL-HPA047454)
Datasheet Anti RIPPLY2 pAb (ATL-HPA047454) Datasheet (External Link)
Vendor Page Anti RIPPLY2 pAb (ATL-HPA047454)