Anti RIPK3 pAb (ATL-HPA055087)

Atlas Antibodies

SKU: ATL-HPA055087-25

• 
• 

Protein Description: receptor-interacting serine-threonine kinase 3
Gene Name: RIPK3
Alternative Gene Name: RIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022221: 38%, ENSRNOG00000020465: 38%
Entrez Gene ID: 11035
Uniprot ID: Q9Y572
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG
• Gene Sequence: EMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG
• Gene ID - Mouse: ENSMUSG00000022221
• Gene ID - Rat: ENSRNOG00000020465
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RIPK3 pAb (ATL-HPA055087) – 1 Found

Du, Yongrui; Bagnjuk, Konstantin; Lawson, Maralee S; Xu, Jing; Mayerhofer, Artur. Acetylcholine and necroptosis are players in follicular development in primates. Scientific Reports. 2018;8(1):6166.