Anti RIOK1 pAb (ATL-HPA051446 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051446-25
  • Immunohistochemistry analysis in human testis and pancreas tissues using HPA051446 antibody. Corresponding RIOK1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli, nuclear speckles & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: RIO kinase 1
Gene Name: RIOK1
Alternative Gene Name: AD034, bA288G3.1, FLJ30006, RRP10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021428: 76%, ENSRNOG00000014049: 76%
Entrez Gene ID: 83732
Uniprot ID: Q9BRS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DWDWDEGVGKLAKGYVWNGGSNPQANRQTSDSSSAKMSTPADKVLRKFENKINLDKLNVTDSVINKVTEKSRQKEADMYRIKD
Gene Sequence DWDWDEGVGKLAKGYVWNGGSNPQANRQTSDSSSAKMSTPADKVLRKFENKINLDKLNVTDSVINKVTEKSRQKEADMYRIKD
Gene ID - Mouse ENSMUSG00000021428
Gene ID - Rat ENSRNOG00000014049
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RIOK1 pAb (ATL-HPA051446 w/enhanced validation)
Datasheet Anti RIOK1 pAb (ATL-HPA051446 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RIOK1 pAb (ATL-HPA051446 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RIOK1 pAb (ATL-HPA051446 w/enhanced validation)
Datasheet Anti RIOK1 pAb (ATL-HPA051446 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RIOK1 pAb (ATL-HPA051446 w/enhanced validation)