Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA066498-25
  • Immunohistochemistry analysis in human fallopian tube and pancreas tissues using HPA066498 antibody. Corresponding RIMS2 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: regulating synaptic membrane exocytosis 2
Gene Name: RIMS2
Alternative Gene Name: KIAA0751, OBOE, RAB3IP3, RIM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037386: 96%, ENSRNOG00000004201: 96%
Entrez Gene ID: 9699
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS
Gene Sequence MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS
Gene ID - Mouse ENSMUSG00000037386
Gene ID - Rat ENSRNOG00000004201
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation)
Datasheet Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation)
Datasheet Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation)