Protein Description: regulating synaptic membrane exocytosis 2
Gene Name: RIMS2
Alternative Gene Name: KIAA0751, OBOE, RAB3IP3, RIM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037386: 96%, ENSRNOG00000004201: 96%
Entrez Gene ID: 9699
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RIMS2
Alternative Gene Name: KIAA0751, OBOE, RAB3IP3, RIM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037386: 96%, ENSRNOG00000004201: 96%
Entrez Gene ID: 9699
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS |
| Documents & Links for Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation) | |
| Datasheet | Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation) at Atlas |
| Documents & Links for Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation) | |
| Datasheet | Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation) |