Anti RIMS2 pAb (ATL-HPA066498 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA066498-25

• 

Protein Description: regulating synaptic membrane exocytosis 2
Gene Name: RIMS2
Alternative Gene Name: KIAA0751, OBOE, RAB3IP3, RIM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037386: 96%, ENSRNOG00000004201: 96%
Entrez Gene ID: 9699
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS
• Gene Sequence: MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS
• Gene ID - Mouse: ENSMUSG00000037386
• Gene ID - Rat: ENSRNOG00000004201
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.