Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045703-25

• 

Protein Description: regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1
Gene Name: RIIAD1
Alternative Gene Name: C1orf230, FLJ36032, NCRNA00166
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028139: 78%, ENSRNOG00000037310: 79%
Entrez Gene ID: 284485
Uniprot ID: A6NNX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIH
• Gene Sequence: METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIH
• Gene ID - Mouse: ENSMUSG00000028139
• Gene ID - Rat: ENSRNOG00000037310
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.