Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation)

Catalog No:
ATL-HPA045703-25
$303.00
Protein Description: regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1
Gene Name: RIIAD1
Alternative Gene Name: C1orf230, FLJ36032, NCRNA00166
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028139: 78%, ENSRNOG00000037310: 79%
Entrez Gene ID: 284485
Uniprot ID: A6NNX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIH
Gene ID - Mouse ENSMUSG00000028139
Gene ID - Rat ENSMUSG00000028139
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation)
Datasheet Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation) at Atlas

Documents & Links for Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation)
Datasheet Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation)