Protein Description: regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1
Gene Name: RIIAD1
Alternative Gene Name: C1orf230, FLJ36032, NCRNA00166
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028139: 78%, ENSRNOG00000037310: 79%
Entrez Gene ID: 284485
Uniprot ID: A6NNX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RIIAD1
Alternative Gene Name: C1orf230, FLJ36032, NCRNA00166
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028139: 78%, ENSRNOG00000037310: 79%
Entrez Gene ID: 284485
Uniprot ID: A6NNX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIH |
Gene ID - Mouse | ENSMUSG00000028139 |
Gene ID - Rat | ENSMUSG00000028139 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation) | |
Datasheet | Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation) at Atlas |
Documents & Links for Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation) | |
Datasheet | Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RIIAD1 pAb (ATL-HPA045703 w/enhanced validation) |