Anti RHPN2 pAb (ATL-HPA051749)
Atlas Antibodies
- SKU:
- ATL-HPA051749-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RHPN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030494: 70%, ENSRNOG00000011885: 71%
Entrez Gene ID: 85415
Uniprot ID: Q8IUC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DHQEKCLSQLYDHMPEGLTPLATLKNDQQRRQLGKSHLRRAMAHHEESVREASLCKKLRSIEVLQKVLCAAQERSRLTYAQHQEEDDLLNL |
Gene Sequence | DHQEKCLSQLYDHMPEGLTPLATLKNDQQRRQLGKSHLRRAMAHHEESVREASLCKKLRSIEVLQKVLCAAQERSRLTYAQHQEEDDLLNL |
Gene ID - Mouse | ENSMUSG00000030494 |
Gene ID - Rat | ENSRNOG00000011885 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RHPN2 pAb (ATL-HPA051749) | |
Datasheet | Anti RHPN2 pAb (ATL-HPA051749) Datasheet (External Link) |
Vendor Page | Anti RHPN2 pAb (ATL-HPA051749) at Atlas Antibodies |
Documents & Links for Anti RHPN2 pAb (ATL-HPA051749) | |
Datasheet | Anti RHPN2 pAb (ATL-HPA051749) Datasheet (External Link) |
Vendor Page | Anti RHPN2 pAb (ATL-HPA051749) |