Anti RHOC pAb (ATL-HPA051461)

Atlas Antibodies

SKU: ATL-HPA051461-25

• 

Protein Description: ras homolog family member C
Gene Name: RHOC
Alternative Gene Name: ARH9, ARHC, RhoC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049739: 29%, ENSRNOG00000020778: 31%
Entrez Gene ID: 389
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDLRKAGTWRTGSVPLATLSAQPRPRRECGRCLRWPLGLASRSARTSVGGAVPFSEIPKAFPTC
• Gene Sequence: KDLRKAGTWRTGSVPLATLSAQPRPRRECGRCLRWPLGLASRSARTSVGGAVPFSEIPKAFPTC
• Gene ID - Mouse: ENSMUSG00000049739
• Gene ID - Rat: ENSRNOG00000020778
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.