Anti RHOBTB2 pAb (ATL-HPA060938)

Atlas Antibodies

SKU: ATL-HPA060938-25

• 
• 

Protein Description: Rho-related BTB domain containing 2
Gene Name: RHOBTB2
Alternative Gene Name: DBC2, KIAA0717
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022075: 98%, ENSRNOG00000017373: 98%
Entrez Gene ID: 23221
Uniprot ID: Q9BYZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRL
• Gene Sequence: GPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRL
• Gene ID - Mouse: ENSMUSG00000022075
• Gene ID - Rat: ENSRNOG00000017373
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.