Anti RHEBL1 pAb (ATL-HPA061001)
Atlas Antibodies
- SKU:
- ATL-HPA061001-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RHEBL1
Alternative Gene Name: FLJ25797, MGC34869
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023755: 81%, ENSRNOG00000054385: 81%
Entrez Gene ID: 121268
Uniprot ID: Q8TAI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSARENQLTQGIFTKVIQEIARVENSYGQERRCHLM |
Gene Sequence | SSARENQLTQGIFTKVIQEIARVENSYGQERRCHLM |
Gene ID - Mouse | ENSMUSG00000023755 |
Gene ID - Rat | ENSRNOG00000054385 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RHEBL1 pAb (ATL-HPA061001) | |
Datasheet | Anti RHEBL1 pAb (ATL-HPA061001) Datasheet (External Link) |
Vendor Page | Anti RHEBL1 pAb (ATL-HPA061001) at Atlas Antibodies |
Documents & Links for Anti RHEBL1 pAb (ATL-HPA061001) | |
Datasheet | Anti RHEBL1 pAb (ATL-HPA061001) Datasheet (External Link) |
Vendor Page | Anti RHEBL1 pAb (ATL-HPA061001) |