Anti RHEBL1 pAb (ATL-HPA061001)

Atlas Antibodies

SKU: ATL-HPA061001-25

• 

Protein Description: Ras homolog enriched in brain like 1
Gene Name: RHEBL1
Alternative Gene Name: FLJ25797, MGC34869
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023755: 81%, ENSRNOG00000054385: 81%
Entrez Gene ID: 121268
Uniprot ID: Q8TAI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSARENQLTQGIFTKVIQEIARVENSYGQERRCHLM
• Gene Sequence: SSARENQLTQGIFTKVIQEIARVENSYGQERRCHLM
• Gene ID - Mouse: ENSMUSG00000023755
• Gene ID - Rat: ENSRNOG00000054385
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.