Protein Description: Rh blood group CcEe antigens
Gene Name: RHCE
Alternative Gene Name: CD240CE, RH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028825: 70%, ENSRNOG00000017130: 70%
Entrez Gene ID: 6006
Uniprot ID: P18577
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RHCE
Alternative Gene Name: CD240CE, RH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028825: 70%, ENSRNOG00000017130: 70%
Entrez Gene ID: 6006
Uniprot ID: P18577
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LNLKIWKAPHVAKYFDDQVFWKFPHLAVGF |
| Documents & Links for Anti RHCE pAb (ATL-HPA077385) | |
| Datasheet | Anti RHCE pAb (ATL-HPA077385) Datasheet (External Link) |
| Vendor Page | Anti RHCE pAb (ATL-HPA077385) at Atlas |
| Documents & Links for Anti RHCE pAb (ATL-HPA077385) | |
| Datasheet | Anti RHCE pAb (ATL-HPA077385) Datasheet (External Link) |
| Vendor Page | Anti RHCE pAb (ATL-HPA077385) |